Peptide Glossary

A research-grade reference library covering peptides studied for healing, growth, metabolic, cognitive and longevity applications. Click any peptide for detailed mechanism, sequence and storage information.

Showing all peptides, sorted alphabetical

Growth Hormone

A first-generation synthetic hexapeptide ghrelin receptor agonist studied for growth hormone release and pronounced appetite-stimulating effects.

D-Trp, D-Phe
Metabolic

A naturally occurring tripeptide and primary intracellular antioxidant, studied for detoxification, redox regulation, and oxidative stress research.

ECG (with γ-peptide bond)
Sexual Health

HCG

A glycoprotein hormone naturally produced during pregnancy, studied for LH-like effects on testicular function, ovulation, and reproductive research.

α subunit + β subunit
Growth Hormone

A potent synthetic hexapeptide ghrelin receptor agonist studied for growth hormone release and direct effects on cardiac tissue via CD36.

D-2-methyl-Trp, D-Phe
Growth Hormone

A long-acting IGF-1 analog with N-terminal extension and reduced IGFBP binding, studied for sustained IGF-1 receptor signaling in research.

MFPAMPLSSLFVN-GPR…
Growth Hormone

A selective pentapeptide ghrelin receptor agonist studied for growth hormone release without affecting cortisol, prolactin, or appetite.

Aib, D-2-Nal, D-Phe
Sexual Health

A peptide encoded by the KISS1 gene, studied as the primary upstream regulator of GnRH and the hypothalamic-pituitary-gonadal axis in research.

YNWNSFGLRF
Anti-Inflammatory

A multi-peptide blend combining anti-inflammatory and healing peptides for combined effects on tissue repair, inflammation, and barrier function.

Additional components vary by supplier
Anti-Inflammatory

KPV

A C-terminal tripeptide fragment of α-MSH studied for anti-inflammatory effects in IBD, skin inflammation, and mucosal inflammation research.

KPV
Anti-Inflammatory

The only known human cathelicidin antimicrobial peptide, studied for antimicrobial activity, immune modulation, and wound healing in research.

[LL-37, 37 aa]
Sexual Health

A synthetic melanocortin receptor agonist studied for effects on melanogenesis, skin pigmentation, appetite, and sexual response in research models.

Not standard 1-letter
Cognitive

A naturally occurring indoleamine hormone produced by the pineal gland, studied for circadian rhythm regulation, sleep timing, and antioxidant effects.

N/A — indoleamine hormone, not a peptide